Description

(Cys0)-Amyloid β-Protein (1-40) CAS NO 208266-35-7 is a synthetic, high-purity peptide fragment corresponding to the human amyloid beta sequence, specifically engineered without cysteine residues. This compound is a critical research tool for studying the molecular mechanisms of Alzheimer's disease and other amyloid-related pathologies. It is primarily utilized by pharmaceutical R&D teams, academic research institutions, and diagnostic developers focused on neurodegenerative disease modeling, drug discovery, and biomarker assay development.

Application

• Alzheimer's Disease Research: Fundamental studies on amyloid beta aggregation kinetics, oligomer formation, and neurotoxicity.
• Drug Discovery Screening: Target compound for high-throughput screening (HTS) assays to identify potential inhibitors of amyloid beta aggregation.
• Biophysical Characterization: Used in techniques like circular dichroism (CD), nuclear magnetic resonance (NMR), and surface plasmon resonance (SPR) to study peptide structure and interactions.
• Antibody Development & Validation: Key antigen for the production and testing of antibodies used in immunohistochemistry, ELISA, and Western blot assays.
• Toxicity & Cell Biology Studies: In vitro models to investigate the cellular pathways and toxic effects induced by amyloid beta peptides.
• Diagnostic Assay Calibration: Reference standard for calibrating assays that measure amyloid beta levels in cerebrospinal fluid (CSF) or blood-based biomarkers.

Basic Information

Product Name	(Cys0)-Amyloid β-Protein (1-40)
CAS No.	208266-35-7
Molecular Formula	C194H295N55O60S
Molecular Weight	4329.8 g/mol
Synonyms	Abeta (1-40); Aβ40; Amyloid β-Protein (1-40); Amyloid β-Peptide (1-40); β-Amyloid (1-40); Cys0-Aβ(1-40); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; Human Amyloid Beta Peptide 1-40; Amyloid Precursor Protein 672-711 (Human)
EINECS	Contact for details

Quality Control

Our (Cys0)-Amyloid β-Protein (1-40) is manufactured under stringent conditions to ensure batch-to-batch consistency and high biological activity. Each lot undergoes comprehensive analytical characterization, including HPLC for purity assessment and Mass Spectrometry (MS) for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and endotoxin levels are provided. Production follows quality management principles suitable for research and in vitro diagnostic (IVD) development.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store lyophilized powder at -20°C or below. Once reconstituted, aliquot and store solutions at -80°C to minimize freeze-thaw cycles. The product is hygroscopic (moisture-sensitive); allow the vial to equilibrate to room temperature in a desiccator before opening to prevent moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by amino acid analysis)
Molecular Weight	4329.8 ± 2 Da (by Mass Spectrometry)
Solubility	Soluble in water, DMSO, or dilute acetic acid
Endotoxin Level	< 1.0 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.