Description

Biotinyl-εahx-Amyloid β-Protein (1-42) is a biotinylated derivative of the amyloid beta peptide fragment 1-42, a key component in the study of Alzheimer's disease pathology. This modified peptide is crucial for advanced biochemical research, enabling highly sensitive detection and isolation techniques through its strong affinity for streptavidin. It is primarily utilized by researchers and diagnostic developers in the fields of neuroscience, biochemistry, and pharmaceutical development. The compound, identified by CAS number 1872440-40-8, serves as an essential tool for investigating protein aggregation, biomarker discovery, and therapeutic target validation.

Application

• Biochemical Research: Used as a tagged probe for studying amyloid beta aggregation kinetics, oligomer formation, and neurotoxicity mechanisms in Alzheimer's disease models.
• Diagnostic Assay Development: Serves as a critical capture antigen or standard in the development of ELISA, Western blot, and other immunoassays for detecting amyloid beta peptides.
• Pull-down and Affinity Purification: Facilitates the isolation and identification of interacting proteins, antibodies, or other biomolecules that bind to amyloid beta (1-42) using streptavidin-biotin technology.
• Neuroscience and Drug Discovery: Employed in high-throughput screening (HTS) platforms to identify and characterize potential inhibitors of amyloid beta aggregation.
• Imaging and Histology: Used in conjunction with streptavidin-conjugated fluorophores or enzymes for precise localization of amyloid beta in tissue sections or cellular models.
• Biomarker Validation: Acts as a reference standard for mass spectrometry and chromatographic methods aimed at quantifying amyloid beta variants in biological fluids.

Basic Information

Product Name	Biotinyl-εahx-Amyloid β-Protein (1-42)
CAS No.	1872440-40-8
Molecular Formula	C226H366N62O71S
Molecular Weight	~ 4514.9 g/mol
Synonyms	Biotin-Ahx-Amyloid β-Protein (1-42); Biotin-6-Aminohexanoic acid-Amyloid β (1-42); Aβ1-42-Biotin; Biotinylated Amyloid Beta Peptide 1-42; Biotin-Ahx-Aβ(1-42); Biotin-Ahx-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA; N-Biotinyl-6-aminohexanoyl-Amyloid β-Protein (1-42); Biotin-ε-Ahx-Aβ42
EINECS	Contact for details

Quality Control

Our Biotinyl-εahx-Amyloid β-Protein (1-42) is produced and controlled under stringent conditions suitable for research applications. Each batch undergoes comprehensive analytical testing to ensure identity, purity, and consistency. A detailed Certificate of Analysis (COA) is provided, typically including data from HPLC for purity assessment, Mass Spectrometry (MS) for identity confirmation, and Amino Acid Analysis (AAA). We adhere to high standards of quality management to ensure reliable performance in sensitive experimental systems.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to minimize moisture uptake. Aliquot into single-use vials after reconstitution to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Consistent with theoretical molecular weight
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70% (by AAA)
Solubility	Soluble in DMSO, dilute aqueous acetic acid, or basic buffers
Water Content (KF)	≤ 5.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.