Description

(Gly2,Cys3)-Amyloid β-Protein (1-30) CAS NO 1802080-88-1 is a specifically modified synthetic peptide fragment derived from the amyloid beta protein sequence, a key target in Alzheimer's disease research. This custom-engineered peptide is crucial for advanced biochemical studies, enabling precise investigation into protein aggregation mechanisms and structure-activity relationships. It is primarily utilized by pharmaceutical R&D departments, academic research institutions, and biotechnology companies focused on neurodegenerative disease therapeutics and diagnostic development.

Application

• Biochemical Research: Fundamental studies on amyloid beta protein folding, misfolding, and aggregation kinetics.
• Drug Discovery Screening: Serving as a target or tool compound in high-throughput assays to identify potential inhibitors of amyloid aggregation.
• Antibody & Diagnostic Development: Used as an antigen for generating and characterizing antibodies specific to modified amyloid beta epitopes for diagnostic applications.
• Structure-Activity Relationship (SAR) Studies: Investigating the impact of specific amino acid substitutions (Gly2, Cys3) on peptide properties and biological activity.
• Biophysical Analysis: Employed in techniques like circular dichroism (CD), nuclear magnetic resonance (NMR), and surface plasmon resonance (SPR) to study conformational changes.
• Toxicity & Mechanism Studies: In vitro and cellular models to understand the neurotoxic effects of specific amyloid beta variants.

Basic Information

Product Name	(Gly2,Cys3)-Amyloid β-Protein (1-30)
CAS No.	1802080-88-1
Molecular Formula	C140H218N42O45S2
Molecular Weight	~3194.6 g/mol
Synonyms	DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLM (with Gly2, Cys3 substitution); Aβ(1-30) (Gly2,Cys3); Amyloid Beta Protein Fragment 1-30 (Gly2,Cys3 variant); Custom Aβ(1-30) peptide; Synthetic Amyloid-β (1-30) analog; Research Peptide DAEF*GHDSGFEVRHQKLVFFAEDVGSNKGAIIGLM (*=substitution); CAS 1802080-88-1
EINECS	Contact for details

Quality Control

Our synthetic peptides are produced under strict quality management systems. Each batch of (Gly2,Cys3)-Amyloid β-Protein (1-30) undergoes comprehensive analytical characterization to ensure identity, purity, and consistency. Standard quality verification includes reversed-phase HPLC for purity assessment and mass spectrometry (MS) for identity confirmation. Certificates of Analysis (COA) detailing lot-specific results are provided with every shipment.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot into single-use quantities to minimize freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (Mass Spec)	Consistent with theoretical molecular weight
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70% (by weight)
Amino Acid Analysis	Within ±10% of theoretical composition
Solubility	Soluble in water or dilute acetic acid

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.