Description

5-Fam-Amyloid β-Protein (1-40) CAS NO 1678416-08-4 is a fluorescently labeled peptide derivative of the amyloid-beta protein, a key biomarker in Alzheimer's disease research. This compound is specifically engineered for advanced fluorescence-based assays, enabling high-sensitivity detection and quantification in complex biological matrices. It is an essential reagent for pharmaceutical R&D, diagnostic development, and academic research focused on neurodegenerative diseases and protein aggregation studies.

Application

• Biomarker Research & Assay Development: Primary tool for developing and validating fluorescence immunoassays (FIA) and ELISA for amyloid-beta detection.
• Drug Discovery & Screening: Used in high-throughput screening (HTS) platforms to identify and evaluate potential therapeutic compounds that inhibit amyloid-beta aggregation.
• Diagnostic Kit Manufacturing: Critical component in the production of in-vitro diagnostic (IVD) kits for Alzheimer's disease biomarker analysis.
• Cellular & Molecular Biology Studies: Enables real-time tracking and visualization of amyloid-beta uptake, localization, and clearance mechanisms in cell culture models.
• Protein-Protein Interaction Analysis: Serves as a fluorescent probe in surface plasmon resonance (SPR) or fluorescence polarization assays to study binding kinetics.
• Quality Control & Reference Standard: Acts as a certified reference material (CRM) for calibrating analytical instruments and ensuring assay reproducibility in GLP/GMP environments.

Basic Information

Product Name	5-Fam-Amyloid β-Protein (1-40)
CAS No.	1678416-08-4
Molecular Formula	C207H311N55O60S
Molecular Weight	~4510.1 g/mol
Synonyms	5-FAM-Aβ(1-40); FAM-Amyloid β-Protein (1-40); Fluorescein-labeled Amyloid Beta (1-40); 5-Carboxyfluorescein-Aβ40; Aβ(1-40)-FAM; 5-FAM-Aβ40; Fluorescent Amyloid-β Peptide; 5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
EINECS	Contact for details

Quality Control

Our 5-Fam-Amyloid β-Protein (1-40) is manufactured under strict quality systems suitable for research and diagnostic use. Each batch undergoes comprehensive analytical characterization, including HPLC for purity verification and mass spectrometry for identity confirmation. We provide full traceability and Certificates of Analysis (COA) detailing purity, concentration, and performance data. Our quality commitment ensures batch-to-batch consistency for reliable experimental results.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. For long-term storage, consider aliquoting to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Single-Letter Sequence	5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Extinction Coefficient (ε)	~83,000 M-1cm-1 at 494 nm
Fluorescence Emission	λmax ~518 nm
Solubility	Soluble in DMSO, aqueous buffers

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.