Description

(Val3)-Amyloid β-Protein (1-40) is a synthetic peptide analog of the amyloid beta protein, a key molecule in Alzheimer's disease research. This modified sequence, incorporating a valine substitution at position 3, is crucial for studying protein aggregation mechanisms, toxicity profiles, and the development of therapeutic inhibitors. It is an essential biochemical tool for researchers and developers in the fields of neuroscience, pharmacology, and diagnostic assay development. The compound is supplied to the highest purity standards to ensure reliable and reproducible experimental results.

Application

• Biomedical Research: Fundamental studies on the aggregation kinetics, structure, and neurotoxicity of amyloid beta peptides relevant to Alzheimer's disease pathology.
• Drug Discovery & Screening: Used as a target substrate in high-throughput screening (HTS) assays to identify and validate potential therapeutic compounds that inhibit aggregation or promote clearance.
• Antibody Development & Validation: Serves as a critical antigen for the production, characterization, and calibration of diagnostic and therapeutic antibodies targeting amyloid beta.
• In Vitro Model Systems: Employed to create controlled cellular and acellular models of amyloidosis to study disease mechanisms and evaluate drug efficacy.
• Biomarker Assay Development: Used as a reference standard in the development and quality control of immunoassays (e.g., ELISA) for detecting amyloid beta variants in biological samples.
• Structural Biology: Provides material for nuclear magnetic resonance (NMR) spectroscopy and X-ray crystallography studies to elucidate the three-dimensional conformation of amyloid beta peptides.

Basic Information

Product Name	(Val3)-Amyloid β-Protein (1-40)
CAS No.	1678415-83-2
Molecular Formula	C194H295N55O58S
Molecular Weight	4329.8 g/mol
Synonyms	Abeta(1-40) V3V; Aβ(1-40) V3V; Amyloid Beta Protein (1-40) Val3 variant; DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; Amyloid β-Peptide (1-40) (human) Val3 analog; (Val3)-Aβ40; Aβ40 V3V; Synthetic Amyloid-β (1-40) peptide (Val3)
EINECS	Contact for details

Quality Control

Every batch of (Val3)-Amyloid β-Protein (1-40) is manufactured and analyzed under strict quality management protocols to ensure identity, purity, and consistency. Our products undergo rigorous quality testing to ensure compliance with industry standards. Certificates of Analysis (COA) are available upon request and provide full analytical data, including purity by HPLC, mass spectrometry confirmation, and endotoxin levels suitable for cell-based applications.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot into single-use vials to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (Mass Spec)	Consistent with theoretical molecular weight
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70%
Water Content (KF)	≤ 5.0%
Acetate Content (HPLC)	≤ 10%
Endotoxin Level	< 10 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.