Description

5-Fam-Amylin (Human) is a fluorescently labeled analog of the human amylin peptide, a key hormone involved in glucose metabolism and satiety signaling. This modified peptide is specifically designed for advanced research applications, offering a powerful tool for visualization and tracking in biological systems. It is primarily utilized by researchers and developers in the pharmaceutical, biotechnology, and life sciences sectors for metabolic disease studies, receptor binding assays, and cellular imaging.

Application

• Biomedical Research: Used as a fluorescent tracer in studies of amylin's role in type 2 diabetes, obesity, and pancreatic function.
• Receptor Binding & Pharmacodynamics: Essential for competitive binding assays to study interactions with the amylin receptor (AMY) and calcitonin receptor (CTR).
• Cellular Imaging & Localization: Enables real-time visualization of peptide uptake, internalization, and subcellular localization in vitro.
• Drug Discovery & Development: Serves as a critical tool in high-throughput screening (HTS) campaigns for identifying novel amylin receptor modulators.
• Metabolic Pathway Analysis: Facilitates the investigation of amylin's effects on insulin secretion, gastric emptying, and glucagon suppression.
• Academic & Institutional Research: Supports fundamental research in endocrinology, neurobiology, and peptide hormone signaling.

Basic Information

Product Name	5-Fam-Amylin (Human)
CAS No.	1678414-71-5
Molecular Formula	C178H267N51O53S2
Molecular Weight	3944.5 g/mol
Synonyms	FAM-Amylin, human; 5-Carboxyfluorescein-Amylin (1-37), human; Fluorescein-labeled Amylin; FAM-hAmylin; IAPP (1-37), human, 5-FAM labeled; Islet Amyloid Polypeptide, FAM conjugate; 5-FAM-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
EINECS	Contact for details

Quality Control

Our 5-Fam-Amylin (Human) is manufactured under strict quality management systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity verification and MS for identity confirmation, to ensure it meets the high standards required for research. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are provided with every shipment.

Storage

Preserve in a tightly closed container, protected from light. Store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to warm to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item	Specification
Appearance	Yellow to orange lyophilized powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80%
Single-Letter Sequence	KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (5-FAM at N-terminus)
Molecular Weight	3944.5 g/mol (theoretical)
Solubility	Soluble in water, DMSO, or aqueous buffer

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.