Description

(Met(O)3)-Amyloid β-Protein (1-40) CAS NO 178302-50-6 is a chemically modified peptide variant of the amyloid beta (Aβ) protein, specifically oxidized at three methionine residues. This high-purity biochemical is critical for advanced research into the molecular mechanisms of oxidative stress and its role in neurodegenerative disease pathology. It is an essential tool for pharmaceutical R&D, academic laboratories, and diagnostic developers focused on Alzheimer's disease and related dementias.

Application

• Neurodegenerative Disease Research: Primary tool for studying the impact of methionine oxidation on Aβ aggregation kinetics, oligomer formation, and neurotoxicity in Alzheimer's disease models.
• Drug Discovery & Screening: Used in high-throughput assays to evaluate potential therapeutic compounds designed to inhibit the aggregation of oxidized amyloid beta species.
• Biomarker Development: Serves as a reference standard in the development of immunoassays and biosensors for detecting oxidized forms of Aβ in biological samples.
• Mechanistic Studies: Enables investigation into the role of reactive oxygen species (ROS) and protein oxidation in the progression of amyloid-related disorders.
• Antibody Production & Validation: Acts as a key antigen for generating and characterizing antibodies specific to oxidized epitopes on the amyloid beta protein.
• Biophysical Characterization: Utilized in techniques like NMR, mass spectrometry, and electron microscopy to determine the structural consequences of methionine sulfoxidation on peptide conformation.

Basic Information

Product Name	(Met(O)3)-Amyloid β-Protein (1-40)
CAS No.	178302-50-6
Molecular Formula	C194H295N55O60S
Molecular Weight	4329.8 g/mol
Synonyms	Aβ(1-40) (Met(O)3); Oxidized Amyloid Beta Protein (1-40); Amyloid β-Peptide (1-40) (Met(O)3); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (Met(O)3); Aβ1-40 with Methionine Sulfoxidation; Aβ1-40 (Oxidized); (Met(O)3)-Aβ(1-40); Oxidized Amyloid-β (1-40)
EINECS	Contact for details

Quality Control

Every batch of (Met(O)3)-Amyloid β-Protein (1-40) is manufactured and analyzed under stringent quality systems. Purity is rigorously confirmed by analytical HPLC and mass spectrometry to ensure identity and consistency for critical research applications. A comprehensive Certificate of Analysis (COA) detailing purity, peptide content, and oxidation state is provided with each shipment.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and hydrolysis. Aliquot into single-use vials after reconstitution to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Consistent with molecular weight
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80%
Oxidation State (MS/MS)	Confirmation of three methionine sulfoxide residues
Solubility	Soluble in water or dilute aqueous acetic acid

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.