Description

Amyloid β-Protein (11-42) CAS NO 157802-70-5 is a specific peptide fragment derived from the amyloid precursor protein (APP), representing a key sequence implicated in amyloid fibril formation. This peptide is of critical importance for researchers studying the molecular mechanisms of protein aggregation and neurotoxicity in Alzheimer's disease and related disorders. It is primarily needed by pharmaceutical R&D laboratories, academic research institutions, and biotechnology companies focused on neurodegenerative disease research, drug discovery, and diagnostic assay development.

Application

• Biomedical Research: Fundamental studies on the kinetics and thermodynamics of amyloid-beta peptide aggregation and fibrillogenesis.
• Drug Discovery Screening: Serving as a target substrate in high-throughput assays to identify and validate potential inhibitors of amyloid-beta aggregation.
• Antibody & Diagnostic Development: Used as an antigen for the production and characterization of specific antibodies, or as a standard in immunoassays (e.g., ELISA) for Alzheimer's disease biomarker research.
• Biophysical Characterization: Employed in techniques such as circular dichroism (CD), nuclear magnetic resonance (NMR), and electron microscopy to study secondary structure and oligomer formation.
• Cellular & Animal Model Studies: Application in vitro cell culture models or in vivo studies to investigate peptide-induced cytotoxicity and pathological effects.
• Reference Standard: Acting as a purified, well-characterized standard for quality control and method validation in related research and development processes.

Basic Information

Product Name	Amyloid β-Protein (11-42)
CAS No.	157802-70-5
Molecular Formula	C144H218N42O43S
Molecular Weight	3263.6 g/mol
Synonyms	Amyloid β-Protein (11-42); Aβ(11-42); Amyloid β-Peptide (11-42); β-Amyloid Peptide (11-42); Aβ11-42; Amyloid Beta (11-42) Fragment; APP(672-713); EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
EINECS	Contact for details

Quality Control

Our Amyloid β-Protein (11-42) is produced and controlled under stringent conditions to ensure batch-to-batch consistency and high purity, suitable for sensitive research applications. Each lot is accompanied by a comprehensive Certificate of Analysis (COA) detailing purity, identity, and other critical parameters. We adhere to relevant quality management principles to support your research and development needs.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive) and easily oxidized; it is recommended to store under an inert atmosphere when the container is opened and to allow it to equilibrate to room temperature in a desiccator before use to minimize moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to structure
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Water Content (KF)	≤ 5.0%
Acetate Content (HPIC)	≤ 10%
Solubility	Soluble in DMSO, dilute aqueous acetic acid, or basic buffers

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.