

share
Il-6 (88-121) (Human) CAS NO 145990-81-4
Unit Price:
CAS No.:145990-81-4
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Il-6 (88-121) (Human) is a defined fragment of the human Interleukin-6 protein, a key cytokine involved in immune regulation and inflammatory responses. This high-purity peptide is critical for research and development in immunology and therapeutic discovery. It is essential for scientists and manufacturers in the pharmaceutical, biotechnology, and diagnostic sectors requiring precise biological tools for assay development, target validation, and antibody production.
Application
- Biomedical Research: Used as a specific antigen in immunological studies to investigate IL-6 signaling pathways, inflammation, and related diseases.
- Antibody Development & Production: Serves as a key immunogen for generating and screening monoclonal or polyclonal antibodies against human IL-6.
- Diagnostic Assay Development: Employed in the calibration and development of ELISA kits, lateral flow assays, and other immunoassays for IL-6 detection.
- Drug Discovery & Validation: Utilized in high-throughput screening (HTS) and binding studies to identify and characterize potential IL-6 inhibitors or therapeutic agents.
- Quality Control & Standardization: Acts as a reference standard in the quality control of IL-6-targeting biologics and diagnostic reagents.
- Cell Culture & Stimulation: Applied in *in vitro* studies to stimulate specific cellular responses in research on hematopoiesis, B-cell differentiation, and acute phase reactions.
Basic Information
| Product Name | Il-6 (88-121) (Human) |
| CAS No. | 145990-81-4 |
| Molecular Formula | C164H263N45O51S2 |
| Molecular Weight | 3792.3 g/mol |
| Synonyms | Interleukin-6 (88-121) (human); IL-6 Fragment (88-121); Human IL-6 Peptide (88-121); IL-6 (88-121) human; Recombinant Human IL-6 (88-121); IL6 (88-121); H-IL6 (88-121); Cytokine IL-6 Peptide |
| EINECS | Contact for details |
Quality Control
Our Il-6 (88-121) (Human) is produced under stringent conditions to ensure batch-to-batch consistency and high biological activity. Each lot undergoes comprehensive analytical testing, including HPLC for purity assessment and mass spectrometry for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and endotoxin levels are available upon request.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This material is hygroscopic (moisture-sensitive). Allow the vial to warm to room temperature in a desiccator before opening to prevent condensation and moisture uptake.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% (by weight) |
| Amino Acid Sequence | H-QVPOQGESKRLQCLLDRKNFHSDMIEQVTSLYFES- OH |
| Molecular Weight | 3792.3 Da (average) |
| Solubility | Soluble in water or PBS buffer |
| Endotoxin Level | < 1.0 EU/μg |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


Bovine Albumin CAS NO 9048-46-8


Albumin From Chicken Egg White CAS NO 9006-59-1


Melanotan-1 CAS NO 75921-69-6


Dermorphin CAS NO 77614-16-5


Dsip CAS NO 62568-57-4


Epitalon CAS NO 307297-39-8


Humanin CAS NO 330936-69-1


H-Gly-Pro-Hyp-Oh CAS NO 2239-67-0


Lactoferrin CAS NO 146897-68-9


Ll-37 CAS NO 154947-66-7


Selank Peptide CAS NO 129954-34-3


Holo-Transferrin CAS NO 11096-37-0


Hyaluronidase CAS NO 37326-33-3


Neuropeptide S (1-10) (Human) CAS NO 904910-39-0


Doreptide CAS NO 90104-48-6


Hirsutide CAS NO 865368-30-5


Nph-Peptide CAS NO 84311-50-2


n-Acetyl-Phe-Octreotide CAS NO 83795-61-3


Ha Peptide CAS NO 92000-76-5


Transdermal Peptide CAS NO 918629-48-8
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






