share

Il-6 (88-121) (Human) CAS NO 145990-81-4


Unit Price:

CAS No.:145990-81-4

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Il-6 (88-121) (Human) is a defined fragment of the human Interleukin-6 protein, a key cytokine involved in immune regulation and inflammatory responses. This high-purity peptide is critical for research and development in immunology and therapeutic discovery. It is essential for scientists and manufacturers in the pharmaceutical, biotechnology, and diagnostic sectors requiring precise biological tools for assay development, target validation, and antibody production.

Application

  • Biomedical Research: Used as a specific antigen in immunological studies to investigate IL-6 signaling pathways, inflammation, and related diseases.
  • Antibody Development & Production: Serves as a key immunogen for generating and screening monoclonal or polyclonal antibodies against human IL-6.
  • Diagnostic Assay Development: Employed in the calibration and development of ELISA kits, lateral flow assays, and other immunoassays for IL-6 detection.
  • Drug Discovery & Validation: Utilized in high-throughput screening (HTS) and binding studies to identify and characterize potential IL-6 inhibitors or therapeutic agents.
  • Quality Control & Standardization: Acts as a reference standard in the quality control of IL-6-targeting biologics and diagnostic reagents.
  • Cell Culture & Stimulation: Applied in *in vitro* studies to stimulate specific cellular responses in research on hematopoiesis, B-cell differentiation, and acute phase reactions.

Basic Information

Product Name Il-6 (88-121) (Human)
CAS No. 145990-81-4
Molecular Formula C164H263N45O51S2
Molecular Weight 3792.3 g/mol
Synonyms Interleukin-6 (88-121) (human); IL-6 Fragment (88-121); Human IL-6 Peptide (88-121); IL-6 (88-121) human; Recombinant Human IL-6 (88-121); IL6 (88-121); H-IL6 (88-121); Cytokine IL-6 Peptide
EINECS Contact for details

Quality Control

Our Il-6 (88-121) (Human) is produced under stringent conditions to ensure batch-to-batch consistency and high biological activity. Each lot undergoes comprehensive analytical testing, including HPLC for purity assessment and mass spectrometry for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and endotoxin levels are available upon request.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This material is hygroscopic (moisture-sensitive). Allow the vial to warm to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC & MS) Conforms to reference standard
Purity (HPLC) ≥ 95%
Peptide Content ≥ 80% (by weight)
Amino Acid Sequence H-QVPOQGESKRLQCLLDRKNFHSDMIEQVTSLYFES- OH
Molecular Weight 3792.3 Da (average)
Solubility Soluble in water or PBS buffer
Endotoxin Level < 1.0 EU/μg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.