

share
(Gln22)-Amyloid β-Protein (1-40) CAS NO 144410-00-4
Unit Price:
CAS No.:144410-00-4
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
(Gln22)-Amyloid β-Protein (1-40) is a synthetic peptide fragment of the amyloid beta protein, featuring a specific glutamine substitution at position 22. This modified sequence is crucial for advanced research into the molecular mechanisms of Alzheimer's disease and related amyloidogenic disorders. It is an essential biochemical tool for scientists in pharmaceutical R&D, academic institutions, and biotechnology companies focused on neurodegenerative disease modeling, drug discovery, and structural biology studies.
Application
- Alzheimer's Disease Research: Used as a key reagent for studying amyloid beta aggregation kinetics, toxicity, and fibril formation in vitro.
- Drug Discovery & Screening: Serves as a target substrate in high-throughput assays to identify and evaluate potential therapeutic inhibitors of amyloid aggregation.
- Biophysical Studies: Employed in structural analysis techniques such as NMR, X-ray crystallography, and electron microscopy to understand peptide conformation and assembly.
- Antibody Development & Validation: Acts as a critical antigen for the production and testing of antibodies specific to amyloid beta variants.
- Cell Culture & Model Systems: Applied in cellular models to induce and study amyloid-related cytotoxicity and pathway activation.
- Biomarker Research: Utilized in the development of diagnostic assays to detect specific amyloid beta species in biological samples.
Basic Information
| Product Name | (Gln22)-Amyloid β-Protein (1-40) |
| CAS No. | 144410-00-4 |
| Molecular Formula | C194H295N55O58S |
| Molecular Weight | 4329.8 g/mol |
| Synonyms | Aβ(1-40) Gln22; Amyloid Beta Protein (1-40), Gln22 variant; DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; β-Amyloid (1-40) (Gln22); Aβ1-40 (Q22); Amyloid-β Peptide 1-40 (Q22); Synthetic Amyloid β-Protein Fragment 1-40 (Gln22) |
| EINECS | Contact for details |
Quality Control
Every batch of (Gln22)-Amyloid β-Protein (1-40) is produced and analyzed under stringent quality protocols to ensure the highest standards of purity, identity, and biological activity for research applications. Our quality assurance includes comprehensive analytical testing via HPLC, MS (Mass Spectrometry), and amino acid analysis. A Certificate of Analysis (COA) detailing purity, peptide content, and analytical data is provided with each shipment to guarantee traceability and reproducibility for your critical experiments.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store lyophilized powder at -20°C or below. Reconstituted solutions should be aliquoted and stored at -80°C to minimize freeze-thaw cycles. This product is hygroscopic (moisture-sensitive); ensure the vial is equilibrated to room temperature before opening to prevent condensation.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 70% (by amino acid analysis) |
| Molecular Weight | 4329.8 ± 2 Da (by MS) |
| Solubility | Soluble in water or dilute aqueous acetic acid |
| Endotoxin Level | < 1.0 EU/mg |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


Bovine Albumin CAS NO 9048-46-8


Albumin From Chicken Egg White CAS NO 9006-59-1


Melanotan-1 CAS NO 75921-69-6


Dermorphin CAS NO 77614-16-5


Dsip CAS NO 62568-57-4


Epitalon CAS NO 307297-39-8


Humanin CAS NO 330936-69-1


H-Gly-Pro-Hyp-Oh CAS NO 2239-67-0


Lactoferrin CAS NO 146897-68-9


Ll-37 CAS NO 154947-66-7


Selank Peptide CAS NO 129954-34-3


Holo-Transferrin CAS NO 11096-37-0


Hyaluronidase CAS NO 37326-33-3


Neuropeptide S (1-10) (Human) CAS NO 904910-39-0


Doreptide CAS NO 90104-48-6


Hirsutide CAS NO 865368-30-5


Nph-Peptide CAS NO 84311-50-2


n-Acetyl-Phe-Octreotide CAS NO 83795-61-3


Ha Peptide CAS NO 92000-76-5


Transdermal Peptide CAS NO 918629-48-8
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






