share

(Gln22)-Amyloid β-Protein (1-40) CAS NO 144410-00-4


Unit Price:

CAS No.:144410-00-4

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

(Gln22)-Amyloid β-Protein (1-40) is a synthetic peptide fragment of the amyloid beta protein, featuring a specific glutamine substitution at position 22. This modified sequence is crucial for advanced research into the molecular mechanisms of Alzheimer's disease and related amyloidogenic disorders. It is an essential biochemical tool for scientists in pharmaceutical R&D, academic institutions, and biotechnology companies focused on neurodegenerative disease modeling, drug discovery, and structural biology studies.

Application

  • Alzheimer's Disease Research: Used as a key reagent for studying amyloid beta aggregation kinetics, toxicity, and fibril formation in vitro.
  • Drug Discovery & Screening: Serves as a target substrate in high-throughput assays to identify and evaluate potential therapeutic inhibitors of amyloid aggregation.
  • Biophysical Studies: Employed in structural analysis techniques such as NMR, X-ray crystallography, and electron microscopy to understand peptide conformation and assembly.
  • Antibody Development & Validation: Acts as a critical antigen for the production and testing of antibodies specific to amyloid beta variants.
  • Cell Culture & Model Systems: Applied in cellular models to induce and study amyloid-related cytotoxicity and pathway activation.
  • Biomarker Research: Utilized in the development of diagnostic assays to detect specific amyloid beta species in biological samples.

Basic Information

Product Name (Gln22)-Amyloid β-Protein (1-40)
CAS No. 144410-00-4
Molecular Formula C194H295N55O58S
Molecular Weight 4329.8 g/mol
Synonyms Aβ(1-40) Gln22; Amyloid Beta Protein (1-40), Gln22 variant; DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; β-Amyloid (1-40) (Gln22); Aβ1-40 (Q22); Amyloid-β Peptide 1-40 (Q22); Synthetic Amyloid β-Protein Fragment 1-40 (Gln22)
EINECS Contact for details

Quality Control

Every batch of (Gln22)-Amyloid β-Protein (1-40) is produced and analyzed under stringent quality protocols to ensure the highest standards of purity, identity, and biological activity for research applications. Our quality assurance includes comprehensive analytical testing via HPLC, MS (Mass Spectrometry), and amino acid analysis. A Certificate of Analysis (COA) detailing purity, peptide content, and analytical data is provided with each shipment to guarantee traceability and reproducibility for your critical experiments.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store lyophilized powder at -20°C or below. Reconstituted solutions should be aliquoted and stored at -80°C to minimize freeze-thaw cycles. This product is hygroscopic (moisture-sensitive); ensure the vial is equilibrated to room temperature before opening to prevent condensation.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC & MS) Conforms to reference standard
Purity (HPLC) ≥ 95%
Peptide Content ≥ 70% (by amino acid analysis)
Molecular Weight 4329.8 ± 2 Da (by MS)
Solubility Soluble in water or dilute aqueous acetic acid
Endotoxin Level < 1.0 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.