Description

Amyloid β-Protein (40-1) is a synthetic peptide fragment corresponding to the N-terminal region of the human amyloid-beta protein, a key molecule in Alzheimer's disease research. This high-purity reference standard is critical for enabling reproducible and reliable scientific investigations into disease mechanisms and therapeutic development. It is an essential reagent for pharmaceutical R&D, academic research, and diagnostic assay development focused on neurodegenerative disorders.

Application

• Biomedical Research: Primary reference standard for studying amyloid-beta aggregation, toxicity, and clearance mechanisms in Alzheimer's disease models.
• Drug Discovery & Screening: Used in high-throughput screening (HTS) assays to identify and validate potential inhibitors of amyloid-beta aggregation or oligomerization.
• Antibody & Diagnostic Development: Critical antigen for the production and characterization of monoclonal/polyclonal antibodies used in ELISA, Western blot, and immunohistochemistry diagnostic kits.
• Biophysical Studies: Employed in structural biology techniques such as NMR, circular dichroism (CD), and surface plasmon resonance (SPR) to analyze peptide conformation and interactions.
• Toxicology & Cell Biology: Used to induce and model amyloid-β-related cytotoxicity in primary neuronal cultures and cell lines.
• Quality Control (QC) Standard: Serves as a system suitability standard for analytical methods (e.g., HPLC, MS) used in the quality control of related biopharmaceuticals.

Basic Information

Product Name	Amyloid β-Protein (40-1)
CAS No.	144409-99-4
Molecular Formula	C194H295N55O60S
Molecular Weight	4324.8 g/mol
Synonyms	Amyloid β-Protein (1-40) fragment; Aβ(1-40); Amyloid β-Peptide (1-40); β-Amyloid (1-40); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; Human Amyloid Beta (1-40); Amyloid Beta 40; Aβ40; Amyloid Precursor Protein 1-40 fragment
EINECS	Contact for details

Quality Control

Our Amyloid β-Protein (40-1) is manufactured under stringent conditions to ensure batch-to-batch consistency and high biological activity. Each lot is subjected to comprehensive analytical characterization, including reverse-phase HPLC for purity assessment and mass spectrometry (MS) for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are provided with every shipment to support your quality and regulatory requirements.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot into single-use vials upon first opening to minimize freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Consistent with theoretical molecular weight
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70% (by amino acid analysis)
Solubility	Soluble in water, dilute acetic acid, or DMSO
Endotoxin Level	< 1.0 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.