

share
Amyloid β-Protein (40-1) CAS NO 144409-99-4
Unit Price:
CAS No.:144409-99-4
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Amyloid β-Protein (40-1) is a synthetic peptide fragment corresponding to the N-terminal region of the human amyloid-beta protein, a key molecule in Alzheimer's disease research. This high-purity reference standard is critical for enabling reproducible and reliable scientific investigations into disease mechanisms and therapeutic development. It is an essential reagent for pharmaceutical R&D, academic research, and diagnostic assay development focused on neurodegenerative disorders.
Application
- Biomedical Research: Primary reference standard for studying amyloid-beta aggregation, toxicity, and clearance mechanisms in Alzheimer's disease models.
- Drug Discovery & Screening: Used in high-throughput screening (HTS) assays to identify and validate potential inhibitors of amyloid-beta aggregation or oligomerization.
- Antibody & Diagnostic Development: Critical antigen for the production and characterization of monoclonal/polyclonal antibodies used in ELISA, Western blot, and immunohistochemistry diagnostic kits.
- Biophysical Studies: Employed in structural biology techniques such as NMR, circular dichroism (CD), and surface plasmon resonance (SPR) to analyze peptide conformation and interactions.
- Toxicology & Cell Biology: Used to induce and model amyloid-β-related cytotoxicity in primary neuronal cultures and cell lines.
- Quality Control (QC) Standard: Serves as a system suitability standard for analytical methods (e.g., HPLC, MS) used in the quality control of related biopharmaceuticals.
Basic Information
| Product Name | Amyloid β-Protein (40-1) |
| CAS No. | 144409-99-4 |
| Molecular Formula | C194H295N55O60S |
| Molecular Weight | 4324.8 g/mol |
| Synonyms | Amyloid β-Protein (1-40) fragment; Aβ(1-40); Amyloid β-Peptide (1-40); β-Amyloid (1-40); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; Human Amyloid Beta (1-40); Amyloid Beta 40; Aβ40; Amyloid Precursor Protein 1-40 fragment |
| EINECS | Contact for details |
Quality Control
Our Amyloid β-Protein (40-1) is manufactured under stringent conditions to ensure batch-to-batch consistency and high biological activity. Each lot is subjected to comprehensive analytical characterization, including reverse-phase HPLC for purity assessment and mass spectrometry (MS) for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are provided with every shipment to support your quality and regulatory requirements.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot into single-use vials upon first opening to minimize freeze-thaw cycles.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (MS) | Consistent with theoretical molecular weight |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 70% (by amino acid analysis) |
| Solubility | Soluble in water, dilute acetic acid, or DMSO |
| Endotoxin Level | < 1.0 EU/mg |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


Bovine Albumin CAS NO 9048-46-8


Albumin From Chicken Egg White CAS NO 9006-59-1


Melanotan-1 CAS NO 75921-69-6


Dermorphin CAS NO 77614-16-5


Dsip CAS NO 62568-57-4


Epitalon CAS NO 307297-39-8


Humanin CAS NO 330936-69-1


H-Gly-Pro-Hyp-Oh CAS NO 2239-67-0


Lactoferrin CAS NO 146897-68-9


Ll-37 CAS NO 154947-66-7


Selank Peptide CAS NO 129954-34-3


Holo-Transferrin CAS NO 11096-37-0


Hyaluronidase CAS NO 37326-33-3


Neuropeptide S (1-10) (Human) CAS NO 904910-39-0


Doreptide CAS NO 90104-48-6


Hirsutide CAS NO 865368-30-5


Nph-Peptide CAS NO 84311-50-2


n-Acetyl-Phe-Octreotide CAS NO 83795-61-3


Ha Peptide CAS NO 92000-76-5


Transdermal Peptide CAS NO 918629-48-8
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






