share

Histone H3(1-35) CAS NO 135990-31-7


Unit Price:

CAS No.:135990-31-7

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Histone H3(1-35) is a defined peptide fragment corresponding to the first 35 amino acids of the N-terminal tail of human Histone H3. This synthetic peptide is a crucial research tool for studying post-translational modifications, chromatin structure, and epigenetic regulation. It is essential for scientists and developers in academic research, pharmaceutical discovery, and diagnostic development who require high-purity, well-characterized biochemical reagents.

Application

  • Epigenetics Research: Used as a substrate for studying key enzymatic modifications such as methylation, acetylation, and phosphorylation.
  • Antibody Production & Validation: Serves as an immunogen for generating antibodies specific to the H3 N-terminal tail or as a control antigen for antibody validation.
  • Biochemical Assay Development: Employed in in vitro assays to screen for inhibitors or activators of histone-modifying enzymes (e.g., histone methyltransferases, acetyltransferases).
  • Chromatin Interaction Studies: Utilized in peptide pull-down experiments to investigate protein-protein interactions within the nucleosome complex.
  • Mass Spectrometry Standard: Acts as a reference standard for the identification and quantification of histone modifications via LC-MS/MS.
  • Diagnostic Kit Component: Can be incorporated into ELISA or other immunoassay platforms for the detection of autoantibodies or specific histone modifications.

Basic Information

Product Name Histone H3(1-35)
CAS No. 135990-31-7
Molecular Formula C164H277N59O51S
Molecular Weight 3790.37 g/mol
Synonyms Histone H3 Peptide (1-35); H3(1-35); H3 N-terminal tail peptide (1-35); ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG; Acetyl-Histone H3 (1-35); Human Histone H3 Residues 1-35; Synthetic Histone H3 Fragment
EINECS Contact for details

Quality Control

Our Histone H3(1-35) is manufactured under stringent conditions to ensure batch-to-batch consistency and high biological activity. Each lot undergoes comprehensive analytical characterization, including HPLC for purity verification and mass spectrometry for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are provided with every shipment to support your research and regulatory needs.

Storage

Preserve in a tightly closed container, protected from light. Store desiccated at -20°C or below for long-term stability. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent moisture absorption.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (Mass Spec) Consistent with theoretical molecular weight
Purity (HPLC) ≥ 95%
Peptide Content ≥ 70% (by weight)
Amino Acid Analysis Within ± 10% of theoretical composition
Solubility Soluble in water or aqueous buffer

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.