

share
Histone H3(1-35) CAS NO 135990-31-7
Unit Price:
CAS No.:135990-31-7
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Histone H3(1-35) is a defined peptide fragment corresponding to the first 35 amino acids of the N-terminal tail of human Histone H3. This synthetic peptide is a crucial research tool for studying post-translational modifications, chromatin structure, and epigenetic regulation. It is essential for scientists and developers in academic research, pharmaceutical discovery, and diagnostic development who require high-purity, well-characterized biochemical reagents.
Application
- Epigenetics Research: Used as a substrate for studying key enzymatic modifications such as methylation, acetylation, and phosphorylation.
- Antibody Production & Validation: Serves as an immunogen for generating antibodies specific to the H3 N-terminal tail or as a control antigen for antibody validation.
- Biochemical Assay Development: Employed in in vitro assays to screen for inhibitors or activators of histone-modifying enzymes (e.g., histone methyltransferases, acetyltransferases).
- Chromatin Interaction Studies: Utilized in peptide pull-down experiments to investigate protein-protein interactions within the nucleosome complex.
- Mass Spectrometry Standard: Acts as a reference standard for the identification and quantification of histone modifications via LC-MS/MS.
- Diagnostic Kit Component: Can be incorporated into ELISA or other immunoassay platforms for the detection of autoantibodies or specific histone modifications.
Basic Information
| Product Name | Histone H3(1-35) |
| CAS No. | 135990-31-7 |
| Molecular Formula | C164H277N59O51S |
| Molecular Weight | 3790.37 g/mol |
| Synonyms | Histone H3 Peptide (1-35); H3(1-35); H3 N-terminal tail peptide (1-35); ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG; Acetyl-Histone H3 (1-35); Human Histone H3 Residues 1-35; Synthetic Histone H3 Fragment |
| EINECS | Contact for details |
Quality Control
Our Histone H3(1-35) is manufactured under stringent conditions to ensure batch-to-batch consistency and high biological activity. Each lot undergoes comprehensive analytical characterization, including HPLC for purity verification and mass spectrometry for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are provided with every shipment to support your research and regulatory needs.
Storage
Preserve in a tightly closed container, protected from light. Store desiccated at -20°C or below for long-term stability. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent moisture absorption.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (Mass Spec) | Consistent with theoretical molecular weight |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 70% (by weight) |
| Amino Acid Analysis | Within ± 10% of theoretical composition |
| Solubility | Soluble in water or aqueous buffer |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


Bovine Albumin CAS NO 9048-46-8


Albumin From Chicken Egg White CAS NO 9006-59-1


Melanotan-1 CAS NO 75921-69-6


Dermorphin CAS NO 77614-16-5


Dsip CAS NO 62568-57-4


Epitalon CAS NO 307297-39-8


Humanin CAS NO 330936-69-1


H-Gly-Pro-Hyp-Oh CAS NO 2239-67-0


Lactoferrin CAS NO 146897-68-9


Ll-37 CAS NO 154947-66-7


Selank Peptide CAS NO 129954-34-3


Holo-Transferrin CAS NO 11096-37-0


Hyaluronidase CAS NO 37326-33-3


Neuropeptide S (1-10) (Human) CAS NO 904910-39-0


Doreptide CAS NO 90104-48-6


Hirsutide CAS NO 865368-30-5


Nph-Peptide CAS NO 84311-50-2


n-Acetyl-Phe-Octreotide CAS NO 83795-61-3


Ha Peptide CAS NO 92000-76-5


Transdermal Peptide CAS NO 918629-48-8
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






