share

Amyloid β-Protein (1-38) CAS NO 131438-74-9


Unit Price:

CAS No.:131438-74-9

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Amyloid β-Protein (1-38) CAS NO 131438-74-9 is a specific, 38-amino acid fragment of the amyloid precursor protein (APP) that is central to Alzheimer's disease research. This synthetic peptide is crucial for studying the mechanisms of amyloid plaque formation, neurotoxicity, and the development of potential therapeutic interventions. It is an essential biochemical tool for researchers and pharmaceutical developers in the fields of neuroscience, biochemistry, and drug discovery.

Application

  • Biochemical Research: Fundamental studies on the aggregation kinetics, structure, and toxicity of amyloid beta peptides.
  • Drug Discovery & Screening: Used as a target or reagent in high-throughput assays to identify and validate potential inhibitors of amyloid aggregation.
  • Antibody & Diagnostic Development: Serves as an antigen for the production and characterization of antibodies used in diagnostic kits and therapeutic research.
  • Neuroscience Studies: Investigation of synaptic dysfunction, neuronal cell death pathways, and the pathophysiology of Alzheimer's disease in cellular and animal models.
  • Biophysical Analysis: Characterization of peptide secondary structure and oligomer formation using techniques like circular dichroism (CD) and nuclear magnetic resonance (NMR).
  • Quality Control Reference: Acts as a reference standard in the quality control of related diagnostic reagents and research kits.

Basic Information

Product Name Amyloid β-Protein (1-38)
CAS No. 131438-74-9
Molecular Formula C185H277N51O58S
Molecular Weight 4131.6 g/mol
Synonyms Amyloid β-Protein (1-38); Aβ (1-38); Amyloid Beta Peptide (1-38); β-Amyloid (1-38); Aβ1-38; Amyloid β (1-38); APP (672-709); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
EINECS Contact for details

Quality Control

Our Amyloid β-Protein (1-38) is produced under stringent conditions to ensure the highest standards of purity and batch-to-batch consistency, suitable for critical research applications. Each lot is accompanied by a comprehensive Certificate of Analysis (COA) detailing purity, identity, and peptide content. We adhere to rigorous quality testing protocols, and specifications can be tailored to meet specific research-grade requirements.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC & MS) Conforms to reference standard
Purity (HPLC) ≥ 95%
Peptide Content ≥ 70%
Molecular Weight (MS) 4131.6 ± 2.0 Da
Solubility Soluble in water or dilute acetic acid

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.