

share
Amyloid β-Protein (1-38) CAS NO 131438-74-9
Unit Price:
CAS No.:131438-74-9
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Amyloid β-Protein (1-38) CAS NO 131438-74-9 is a specific, 38-amino acid fragment of the amyloid precursor protein (APP) that is central to Alzheimer's disease research. This synthetic peptide is crucial for studying the mechanisms of amyloid plaque formation, neurotoxicity, and the development of potential therapeutic interventions. It is an essential biochemical tool for researchers and pharmaceutical developers in the fields of neuroscience, biochemistry, and drug discovery.
Application
- Biochemical Research: Fundamental studies on the aggregation kinetics, structure, and toxicity of amyloid beta peptides.
- Drug Discovery & Screening: Used as a target or reagent in high-throughput assays to identify and validate potential inhibitors of amyloid aggregation.
- Antibody & Diagnostic Development: Serves as an antigen for the production and characterization of antibodies used in diagnostic kits and therapeutic research.
- Neuroscience Studies: Investigation of synaptic dysfunction, neuronal cell death pathways, and the pathophysiology of Alzheimer's disease in cellular and animal models.
- Biophysical Analysis: Characterization of peptide secondary structure and oligomer formation using techniques like circular dichroism (CD) and nuclear magnetic resonance (NMR).
- Quality Control Reference: Acts as a reference standard in the quality control of related diagnostic reagents and research kits.
Basic Information
| Product Name | Amyloid β-Protein (1-38) |
| CAS No. | 131438-74-9 |
| Molecular Formula | C185H277N51O58S |
| Molecular Weight | 4131.6 g/mol |
| Synonyms | Amyloid β-Protein (1-38); Aβ (1-38); Amyloid Beta Peptide (1-38); β-Amyloid (1-38); Aβ1-38; Amyloid β (1-38); APP (672-709); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| EINECS | Contact for details |
Quality Control
Our Amyloid β-Protein (1-38) is produced under stringent conditions to ensure the highest standards of purity and batch-to-batch consistency, suitable for critical research applications. Each lot is accompanied by a comprehensive Certificate of Analysis (COA) detailing purity, identity, and peptide content. We adhere to rigorous quality testing protocols, and specifications can be tailored to meet specific research-grade requirements.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 70% |
| Molecular Weight (MS) | 4131.6 ± 2.0 Da |
| Solubility | Soluble in water or dilute acetic acid |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


Bovine Albumin CAS NO 9048-46-8


Albumin From Chicken Egg White CAS NO 9006-59-1


Melanotan-1 CAS NO 75921-69-6


Dermorphin CAS NO 77614-16-5


Dsip CAS NO 62568-57-4


Epitalon CAS NO 307297-39-8


Humanin CAS NO 330936-69-1


H-Gly-Pro-Hyp-Oh CAS NO 2239-67-0


Lactoferrin CAS NO 146897-68-9


Ll-37 CAS NO 154947-66-7


Selank Peptide CAS NO 129954-34-3


Holo-Transferrin CAS NO 11096-37-0


Hyaluronidase CAS NO 37326-33-3


Neuropeptide S (1-10) (Human) CAS NO 904910-39-0


Doreptide CAS NO 90104-48-6


Hirsutide CAS NO 865368-30-5


Nph-Peptide CAS NO 84311-50-2


n-Acetyl-Phe-Octreotide CAS NO 83795-61-3


Ha Peptide CAS NO 92000-76-5


Transdermal Peptide CAS NO 918629-48-8
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






