Description

Exendin-3 is a synthetic 39-amino acid peptide hormone analog, identified by CAS number 130357-25-4. This compound is of significant interest in pharmaceutical research due to its role as a glucagon-like peptide-1 (GLP-1) receptor agonist, influencing insulin secretion and glucose metabolism. It is primarily utilized by research institutions and pharmaceutical developers focused on metabolic disorders, diabetes therapeutics, and endocrine system studies.

Application

• Pharmaceutical Research & Development: Serves as a critical reference standard and active pharmaceutical ingredient (API) in the development of novel therapeutics for Type 2 diabetes and obesity.
• Biochemical Assays: Used as a high-purity ligand in receptor binding studies, functional cellular assays, and signal transduction pathway analysis related to the GLP-1 receptor.
• Preclinical Studies: Employed in animal model research to investigate the pharmacokinetics, efficacy, and safety profiles of GLP-1-based treatments.
• Peptide Chemistry & Synthesis: Acts as a benchmark compound for method development in peptide synthesis, purification, and analytical characterization.
• Diagnostic Tool Development: Utilized in the calibration and validation of immunoassays designed to measure GLP-1 activity or related biomarkers.

Basic Information

Product Name	Exendin-3
CAS No.	130357-25-4
Molecular Formula	C184H282N50O57S
Molecular Weight	4189.6 g/mol
Synonyms	Exendin 3; Exendin-3 peptide; [Ser2]-Exendin-4; Helodermin; Exendin (Heloderma suspectum); HSEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2; 130357-25-4
EINECS	Contact for details

Quality Control

Our Exendin-3 is manufactured under strict quality management systems. Each batch is subjected to comprehensive analytical testing, including identity confirmation by mass spectrometry (MS) and purity assessment by reverse-phase high-performance liquid chromatography (RP-HPLC). Certificates of Analysis (COA) detailing purity, peptide content, and related substance profiles are provided to ensure compliance with your research and development specifications.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. This product is hygroscopic (moisture-sensitive). For long-term storage, consider lyophilized powder under inert atmosphere. Allow the vial to equilibrate to room temperature before opening to minimize moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Conforms to structure
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Single Impurity (HPLC)	≤ 1.0%
Water Content (KF)	≤ 5.0%
Acetate Content (HPLC)	≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.