share

Exendin-3 CAS NO 130357-25-4


Unit Price:

CAS No.:130357-25-4

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Exendin-3 is a synthetic 39-amino acid peptide hormone analog, identified by CAS number 130357-25-4. This compound is of significant interest in pharmaceutical research due to its role as a glucagon-like peptide-1 (GLP-1) receptor agonist, influencing insulin secretion and glucose metabolism. It is primarily utilized by research institutions and pharmaceutical developers focused on metabolic disorders, diabetes therapeutics, and endocrine system studies.

Application

  • Pharmaceutical Research & Development: Serves as a critical reference standard and active pharmaceutical ingredient (API) in the development of novel therapeutics for Type 2 diabetes and obesity.
  • Biochemical Assays: Used as a high-purity ligand in receptor binding studies, functional cellular assays, and signal transduction pathway analysis related to the GLP-1 receptor.
  • Preclinical Studies: Employed in animal model research to investigate the pharmacokinetics, efficacy, and safety profiles of GLP-1-based treatments.
  • Peptide Chemistry & Synthesis: Acts as a benchmark compound for method development in peptide synthesis, purification, and analytical characterization.
  • Diagnostic Tool Development: Utilized in the calibration and validation of immunoassays designed to measure GLP-1 activity or related biomarkers.

Basic Information

Product Name Exendin-3
CAS No. 130357-25-4
Molecular Formula C184H282N50O57S
Molecular Weight 4189.6 g/mol
Synonyms Exendin 3; Exendin-3 peptide; [Ser2]-Exendin-4; Helodermin; Exendin (Heloderma suspectum); HSEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2; 130357-25-4
EINECS Contact for details

Quality Control

Our Exendin-3 is manufactured under strict quality management systems. Each batch is subjected to comprehensive analytical testing, including identity confirmation by mass spectrometry (MS) and purity assessment by reverse-phase high-performance liquid chromatography (RP-HPLC). Certificates of Analysis (COA) detailing purity, peptide content, and related substance profiles are provided to ensure compliance with your research and development specifications.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. This product is hygroscopic (moisture-sensitive). For long-term storage, consider lyophilized powder under inert atmosphere. Allow the vial to equilibrate to room temperature before opening to minimize moisture uptake.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (MS) Conforms to structure
Purity (HPLC) ≥ 95%
Peptide Content ≥ 80% (by weight)
Single Impurity (HPLC) ≤ 1.0%
Water Content (KF) ≤ 5.0%
Acetate Content (HPLC) ≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.