

share
Neuropeptide Y, Porcine CAS NO 125521-61-1
Unit Price:
CAS No.:125521-61-1
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Neuropeptide Y, Porcine is a 36-amino acid peptide hormone that acts as a potent orexigenic agent and vasoconstrictor. This high-purity peptide is critical for advanced research in neurobiology, endocrinology, and metabolic disorders. It is primarily utilized by pharmaceutical R&D teams, academic research institutions, and biotechnology companies focusing on appetite regulation, cardiovascular function, and stress response pathways.
Application
- Neuroscience Research: Used as a standard or reagent in studies investigating central nervous system signaling, particularly related to feeding behavior, anxiety, and energy homeostasis.
- Cardiovascular Studies: Employed in research models to study its potent vasoconstrictive effects and role in blood pressure regulation.
- Metabolic Disorder Research: A key tool for exploring the pathophysiology of obesity, diabetes, and metabolic syndrome.
- Drug Discovery & Development: Serves as a reference compound or target in screening assays for developing novel therapeutics targeting NPY receptors (Y1, Y2, Y4, Y5, Y6).
- Biochemical Assays: Used in receptor binding studies, functional cellular assays, and as a calibration standard in analytical methods like HPLC and mass spectrometry.
- Academic & Institutional Research: Fundamental reagent for graduate and post-doctoral research in physiology and pharmacology departments.
Basic Information
| Product Name | Neuropeptide Y, Porcine |
| CAS No. | 125521-61-1 |
| Molecular Formula | C190H287N55O57S |
| Molecular Weight | 4251.8 g/mol |
| Synonyms | NPY (Porcine); Porcine Neuropeptide Y; Neuropeptide Y (swine); pNPY; YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (Disulfide bridge: Cys7-Cys21); Pancreatic Polypeptide, Neuropeptide Y Precursor (Porcine); NPY, Porcine |
| EINECS | Contact for details |
Quality Control
Our Neuropeptide Y, Porcine is manufactured under strict quality systems to ensure batch-to-batch consistency and high biological activity. Each lot undergoes comprehensive analytical characterization, including purity assessment by HPLC, mass confirmation, and peptide content analysis. Certificates of Analysis (COA) detailing all specifications and test results are provided and available upon request.
Storage
Preserve in a tightly closed container, protected from light. Store at -20°C or below. This product is hygroscopic (moisture-sensitive). For long-term storage, it is recommended to store desiccated at -80°C. Allow the vial to warm to room temperature in a desiccator before opening to prevent condensation and moisture uptake.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC) | Retention time corresponds to reference standard |
| Identification (MS) | Molecular weight confirmed by Mass Spectrometry |
| Purity (HPLC) | ≥ 95% (Area Percent) |
| Peptide Content | ≥ 80% (by weight) |
| Water Content (KF) | ≤ 5.0% |
| Acetate Content (HPIC) | ≤ 10.0% |
| Biological Activity | Confirmed by functional assay (e.g., receptor binding) |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


Bovine Albumin CAS NO 9048-46-8


Albumin From Chicken Egg White CAS NO 9006-59-1


Melanotan-1 CAS NO 75921-69-6


Dermorphin CAS NO 77614-16-5


Dsip CAS NO 62568-57-4


Epitalon CAS NO 307297-39-8


Humanin CAS NO 330936-69-1


H-Gly-Pro-Hyp-Oh CAS NO 2239-67-0


Lactoferrin CAS NO 146897-68-9


Ll-37 CAS NO 154947-66-7


Selank Peptide CAS NO 129954-34-3


Holo-Transferrin CAS NO 11096-37-0


Hyaluronidase CAS NO 37326-33-3


Neuropeptide S (1-10) (Human) CAS NO 904910-39-0


Doreptide CAS NO 90104-48-6


Hirsutide CAS NO 865368-30-5


Nph-Peptide CAS NO 84311-50-2


n-Acetyl-Phe-Octreotide CAS NO 83795-61-3


Ha Peptide CAS NO 92000-76-5


Transdermal Peptide CAS NO 918629-48-8
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






