share

Neuropeptide Y, Porcine CAS NO 125521-61-1


Unit Price:

CAS No.:125521-61-1

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Neuropeptide Y, Porcine is a 36-amino acid peptide hormone that acts as a potent orexigenic agent and vasoconstrictor. This high-purity peptide is critical for advanced research in neurobiology, endocrinology, and metabolic disorders. It is primarily utilized by pharmaceutical R&D teams, academic research institutions, and biotechnology companies focusing on appetite regulation, cardiovascular function, and stress response pathways.

Application

  • Neuroscience Research: Used as a standard or reagent in studies investigating central nervous system signaling, particularly related to feeding behavior, anxiety, and energy homeostasis.
  • Cardiovascular Studies: Employed in research models to study its potent vasoconstrictive effects and role in blood pressure regulation.
  • Metabolic Disorder Research: A key tool for exploring the pathophysiology of obesity, diabetes, and metabolic syndrome.
  • Drug Discovery & Development: Serves as a reference compound or target in screening assays for developing novel therapeutics targeting NPY receptors (Y1, Y2, Y4, Y5, Y6).
  • Biochemical Assays: Used in receptor binding studies, functional cellular assays, and as a calibration standard in analytical methods like HPLC and mass spectrometry.
  • Academic & Institutional Research: Fundamental reagent for graduate and post-doctoral research in physiology and pharmacology departments.

Basic Information

Product Name Neuropeptide Y, Porcine
CAS No. 125521-61-1
Molecular Formula C190H287N55O57S
Molecular Weight 4251.8 g/mol
Synonyms NPY (Porcine); Porcine Neuropeptide Y; Neuropeptide Y (swine); pNPY; YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (Disulfide bridge: Cys7-Cys21); Pancreatic Polypeptide, Neuropeptide Y Precursor (Porcine); NPY, Porcine
EINECS Contact for details

Quality Control

Our Neuropeptide Y, Porcine is manufactured under strict quality systems to ensure batch-to-batch consistency and high biological activity. Each lot undergoes comprehensive analytical characterization, including purity assessment by HPLC, mass confirmation, and peptide content analysis. Certificates of Analysis (COA) detailing all specifications and test results are provided and available upon request.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below. This product is hygroscopic (moisture-sensitive). For long-term storage, it is recommended to store desiccated at -80°C. Allow the vial to warm to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC) Retention time corresponds to reference standard
Identification (MS) Molecular weight confirmed by Mass Spectrometry
Purity (HPLC) ≥ 95% (Area Percent)
Peptide Content ≥ 80% (by weight)
Water Content (KF) ≤ 5.0%
Acetate Content (HPIC) ≤ 10.0%
Biological Activity Confirmed by functional assay (e.g., receptor binding)

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.