Description

Calcitonin Gene Related Peptide (CGRP) II, Rat is a synthetic neuropeptide analog of the potent vasodilator CGRP, specifically the rat isoform. This high-purity peptide is critical for advanced neuroscience and cardiovascular research, enabling precise study of receptor mechanisms and signaling pathways. It is an essential tool for pharmaceutical R&D teams, academic researchers, and diagnostic developers focused on migraine, cardiovascular regulation, and neurogenic inflammation.

Application

• Neuroscience Research: Used as a reference standard and active agent in studies of CGRP receptor binding, neuronal signaling, and central/peripheral nervous system function.
• Cardiovascular Pharmacology: Employed in vitro and in vivo to investigate vasodilation, blood pressure regulation, and vascular smooth muscle activity.
• Migraine & Pain Research: Serves as a key biological tool for modeling migraine pathophysiology and screening potential CGRP receptor antagonist therapeutics.
• Biochemical Assay Development: Acts as a calibrated standard in ELISA, RIA, and other immunoassays for quantifying CGRP levels in biological samples.
• Academic & Institutional Research: Supports fundamental studies in physiology, endocrinology, and molecular biology within university and government laboratories.
• Pharmaceutical Development: Utilized in preclinical stages for target validation, efficacy testing, and safety pharmacology studies for new drug candidates.

Basic Information

Item	Detail
Product Name	Calcitonin Gene Related Peptide (CGRP) II, Rat
CAS No.	99889-63-1
Molecular Formula	C164H263N51O48S2
Molecular Weight	3795.3 g/mol
Synonyms	Rat CGRP-II; CGRP 2, rat; Calcitonin Gene-Related Peptide Type II (rat); α-CGRP (rat); Calcitonin gene-related peptide 2 (Rattus norvegicus); CGRP-II (rat); CGRP2, rat; TNRGATCVAHRLANFLVHSSNNFGPLLNLAKKYLNSLVAS
EINECS	Contact for details

Quality Control

Every batch of Calcitonin Gene Related Peptide (CGRP) II, Rat is manufactured and analyzed under strict quality management systems. Our products undergo rigorous quality testing, including HPLC for purity and MS for identity confirmation, to ensure compliance with research-grade standards. Certificates of Analysis (COA) with detailed chromatographic data are available upon request.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. This product is hygroscopic (moisture-sensitive). For long-term storage, consider desiccant and under an inert atmosphere. Allow the vial to reach room temperature before opening to minimize moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80%
Water Content (KF)	≤ 5.0%
Acetate Content (HPLC)	≤ 10.0%
Solubility	Soluble in water or dilute acetic acid

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.