

share
Calcitonin Gene Related Peptide (Cgrp) Ii, Rat CAS NO 99889-63-1
Unit Price:
CAS No.:99889-63-1
Grade:Pharmacy Grade
Content:99.0%
Brand:Customizable
Packaging:Customizable
Description
Calcitonin Gene Related Peptide (CGRP) II, Rat is a synthetic neuropeptide analog of the potent vasodilator CGRP, specifically the rat isoform. This high-purity peptide is critical for advanced neuroscience and cardiovascular research, enabling precise study of receptor mechanisms and signaling pathways. It is an essential tool for pharmaceutical R&D teams, academic researchers, and diagnostic developers focused on migraine, cardiovascular regulation, and neurogenic inflammation.
Application
- Neuroscience Research: Used as a reference standard and active agent in studies of CGRP receptor binding, neuronal signaling, and central/peripheral nervous system function.
- Cardiovascular Pharmacology: Employed in vitro and in vivo to investigate vasodilation, blood pressure regulation, and vascular smooth muscle activity.
- Migraine & Pain Research: Serves as a key biological tool for modeling migraine pathophysiology and screening potential CGRP receptor antagonist therapeutics.
- Biochemical Assay Development: Acts as a calibrated standard in ELISA, RIA, and other immunoassays for quantifying CGRP levels in biological samples.
- Academic & Institutional Research: Supports fundamental studies in physiology, endocrinology, and molecular biology within university and government laboratories.
- Pharmaceutical Development: Utilized in preclinical stages for target validation, efficacy testing, and safety pharmacology studies for new drug candidates.
Basic Information
| Item | Detail |
|---|---|
| Product Name | Calcitonin Gene Related Peptide (CGRP) II, Rat |
| CAS No. | 99889-63-1 |
| Molecular Formula | C164H263N51O48S2 |
| Molecular Weight | 3795.3 g/mol |
| Synonyms | Rat CGRP-II; CGRP 2, rat; Calcitonin Gene-Related Peptide Type II (rat); α-CGRP (rat); Calcitonin gene-related peptide 2 (Rattus norvegicus); CGRP-II (rat); CGRP2, rat; TNRGATCVAHRLANFLVHSSNNFGPLLNLAKKYLNSLVAS |
| EINECS | Contact for details |
Quality Control
Every batch of Calcitonin Gene Related Peptide (CGRP) II, Rat is manufactured and analyzed under strict quality management systems. Our products undergo rigorous quality testing, including HPLC for purity and MS for identity confirmation, to ensure compliance with research-grade standards. Certificates of Analysis (COA) with detailed chromatographic data are available upon request.
Storage
Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. This product is hygroscopic (moisture-sensitive). For long-term storage, consider desiccant and under an inert atmosphere. Allow the vial to reach room temperature before opening to minimize moisture uptake.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% |
| Water Content (KF) | ≤ 5.0% |
| Acetate Content (HPLC) | ≤ 10.0% |
| Solubility | Soluble in water or dilute acetic acid |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


Bovine Albumin CAS NO 9048-46-8


Albumin From Chicken Egg White CAS NO 9006-59-1


Dermorphin CAS NO 77614-16-5


Melanotan-1 CAS NO 75921-69-6


Dsip CAS NO 62568-57-4


Humanin CAS NO 330936-69-1


Epitalon CAS NO 307297-39-8


H-Gly-Pro-Hyp-Oh CAS NO 2239-67-0


Lactoferrin CAS NO 146897-68-9


Ll-37 CAS NO 154947-66-7


Selank Peptide CAS NO 129954-34-3


Holo-Transferrin CAS NO 11096-37-0


Hyaluronidase CAS NO 37326-33-3


n-Acetyl-Phe-Octreotide CAS NO 83795-61-3


Nph-Peptide CAS NO 84311-50-2


Hirsutide CAS NO 865368-30-5


Doreptide CAS NO 90104-48-6


Neuropeptide S (1-10) (Human) CAS NO 904910-39-0


Ha Peptide CAS NO 92000-76-5


Transdermal Peptide CAS NO 918629-48-8
Why choose US
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






